|
HS Code |
324622 |
| Product Name | Pancreatic Polypeptides |
| Molecular Formula | C136H220N42O41 |
| Molecular Weight | 4200 Da |
| Source | Human pancreas |
| Appearance | White to off-white powder |
| Solubility | Soluble in water |
| Storage Temperature | -20°C |
| Purity | ≥95% (HPLC) |
| Cas Number | 58069-89-1 |
| Sequence | APLEPVYPGDNATPEQMAQYAAELRRYINMLTRPRY |
As an accredited Pancreatic Polypeptides factory, we enforce strict quality protocols—every batch undergoes rigorous testing to ensure consistent efficacy and safety standards.
| Packing | White, opaque plastic vial containing 10 mg Pancreatic Polypeptides, sealed with a tamper-evident cap and labeled with product details. |
| Shipping | Pancreatic Polypeptides are shipped in temperature-controlled packaging, typically on dry ice, to maintain stability and preserve bioactivity. The shipment complies with IATA regulations for biological substances, ensuring safe and secure delivery. Documentation, such as SDS and CoA, accompanies all orders to support proper handling and regulatory compliance upon receipt. |
| Storage | Pancreatic Polypeptides should be stored at -20°C or lower, protected from light and moisture. Store in a tightly sealed container to prevent degradation or contamination. Avoid repeated freeze-thaw cycles. Before use, allow the vial to reach room temperature gradually. If supplied in lyophilized form, reconstitute only before use and store aliquots as recommended by the manufacturer. |
Competitive Pancreatic Polypeptides prices that fit your budget—flexible terms and customized quotes for every order.
For samples, pricing, or more information, please contact us at +8615371019725 or mail to sales7@bouling-chem.com.
We will respond to you as soon as possible.
Tel: +8615371019725
Email: sales7@bouling-chem.com
Flexible payment, competitive price, premium service - Inquire now!
