|
HS Code |
682457 |
| Chemical Name | Glucagon-like peptide-1 (7-37) Acetate |
| Sequence | HGEGTFTSDVSSYLEGQAAKEFIAWLVKGRG |
| Molecular Formula | C151H229N41O46 |
| Molecular Weight | 3297.7 Da |
| Purity | ≥95% (HPLC) |
| Physical Form | Lyophilized powder |
| Solubility | Water or sterile saline |
| Storage Temperature | -20°C |
| Peptide Length | 31 amino acids |
| Cas Number | 106612-94-6 |
As an accredited Glp-1(7- 37) Acetate factory, we enforce strict quality protocols—every batch undergoes rigorous testing to ensure consistent efficacy and safety standards.
| Packing | Glp-1(7-37) Acetate is packaged in a clear, sealed 5mg vial, clearly labeled with product name, quantity, and storage instructions. |
| Shipping | Glp-1(7-37) Acetate is shipped in lyophilized form at ambient temperature with secure packaging to maintain stability during transit. Upon receipt, it is recommended to store the peptide at -20°C for long-term preservation. Shipping is compliant with relevant regulations for research chemicals and includes documentation for safe handling. |
| Storage | **Glp-1(7-37) Acetate** should be stored at –20°C in a tightly sealed container, protected from light and moisture. For long-term storage, keep it desiccated and avoid repeated freeze-thaw cycles. Before use, equilibrate to room temperature and reconstitute in sterile water or buffer as recommended. Proper storage ensures stability and preserves the peptide’s biological activity. |
Competitive Glp-1(7- 37) Acetate prices that fit your budget—flexible terms and customized quotes for every order.
For samples, pricing, or more information, please contact us at +8615371019725 or mail to sales7@bouling-chem.com.
We will respond to you as soon as possible.
Tel: +8615371019725
Email: sales7@bouling-chem.com
Flexible payment, competitive price, premium service - Inquire now!
