|
HS Code |
240197 |
| Name | Crf (Human, Rat) Acetate |
| Synonyms | Corticotropin-Releasing Factor (CRF), Corticoliberin |
| Cas Number | 86784-80-7 |
| Sequence | SEEPPISLDLTFHLLREVLEMARAEQLAQQAHSNRKLMEII |
| Molecular Formula | C203H317N55O60S |
| Molecular Weight | 4758.2 g/mol |
| Purity | ≥95% (HPLC) |
| Form | Lyophilized powder |
| Source | Synthetic (human and rat sequence) |
| Storage Temperature | -20°C |
| Solubility | Soluble in water or aqueous buffers |
| Peptide Classification | Neuropeptide hormone |
| Application | Research use, neuroendocrinology studies |
| Appearance | White to off-white solid |
| Unii | 016LQQ2084 |
As an accredited Crf (Human, Rat) Acetate factory, we enforce strict quality protocols—every batch undergoes rigorous testing to ensure consistent efficacy and safety standards.
| Packing | The product comes in a sterile, amber glass vial containing 1 mg Crf (Human, Rat) Acetate, sealed for laboratory use. |
| Shipping | Crf (Human, Rat) Acetate is shipped at room temperature as a lyophilized powder to ensure stability during transit. Upon receipt, it should be stored at -20°C for long-term preservation. The packaging ensures protection from moisture and light, maintaining product integrity throughout the shipping process. |
| Storage | **Storage Description for Crf (Human, Rat) Acetate:** Store Crf (Human, Rat) Acetate at -20°C, protected from light and moisture. Keep the lyophilized powder tightly sealed in its original vial until ready to use. After reconstitution, aliquot and store at -20°C or lower; avoid repeated freeze-thaw cycles for optimal stability. Ensure proper labeling and handle according to safety guidelines for peptides. |
Competitive Crf (Human, Rat) Acetate prices that fit your budget—flexible terms and customized quotes for every order.
For samples, pricing, or more information, please contact us at +8615371019725 or mail to sales7@bouling-chem.com.
We will respond to you as soon as possible.
Tel: +8615371019725
Email: sales7@bouling-chem.com
Flexible payment, competitive price, premium service - Inquire now!
